Protein Info for IAI47_12405 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 386 to 409 (24 residues), see Phobius details amino acids 419 to 444 (26 residues), see Phobius details amino acids 511 to 530 (20 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 436 (394 residues), 54.9 bits, see alignment E=3.5e-19

Best Hits

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_0828)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>IAI47_12405 MFS transporter (Pantoea sp. MT58)
MAKRNPYAAREWLPHEKPMLPGSPSTPLHPMPKRLAFGLIGLLISLTGALSNALVTANLV
NLQGTFGAWSNEIAWLPAVYVMGNISINLLLVKFRQQFGLRVFTEAFLVLYVLVAFFHLF
ANDLSSAIIVRTAHGMVAAALSSLGIYYQVQAWPAKHRLKALVIGLTVSQLAIPLARLFS
SELLQLNEWRGLYLFELGLALIALGGVLLVKLPPGDRIKTFEKMDFLTFVLLAPGMALLC
GVLTLGRIEWWFTTPWLGICTAIALTLIVAAIVIEHNRRNPLINTRWLSSGMMVRLGIVM
VMIRIVLAEQNTGAIGFLQQMGLQNDQMRGLALAIMAGVIVGIAASALTIKPNHLNWPIV
ASLVVMIIASLMDAQSSPLTRGPEMYLSQFLLGFSSAFFMAPAMLMGIGSVVTQPKNLVS
FVVLFGMSQNLGGLIGSAILGTFQVWREKYHSSLLGDQLSLLDPNVTERLSQYNALFNSL
VGDDVLRGAQSTTQLQTVATLQANVLAYNDTYLLTAALALVTLMWVIWRLTRRRYLDWRQ
AQFNLREQQQLAALQESTEKQ