Protein Info for IAI47_12400 in Pantoea sp. MT58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF00529: CusB_dom_1" amino acids 42 to 352 (311 residues), 31.6 bits, see alignment E=2.5e-11 PF16576: HlyD_D23" amino acids 61 to 305 (245 residues), 58.2 bits, see alignment E=1.5e-19 PF13533: Biotin_lipoyl_2" amino acids 63 to 110 (48 residues), 42.5 bits, see alignment 8.8e-15 PF13437: HlyD_3" amino acids 229 to 307 (79 residues), 44.4 bits, see alignment E=4.8e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_0829)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>IAI47_12400 HlyD family secretion protein (Pantoea sp. MT58)
MSQQDELQAAERERANRRRILSIAAGSGIVVIGVLVILYAWQLWPFTSAIQSTENAYVRG
QVTFISPQVNGYLTSVKVIDLQPVKKGQLLMTIDDRIYRQRVHQAQAQLAMKQAALKNNL
QQRRSAEATIQSNKAALENAKAQALKSGFDLKRVENLAADGSLSVRERDAARAANAQAQA
QVRQAAAQIAVAQQNLQTVIVNRDALEGDVESARAALELAEIDLANTRITAPDDGQLGQL
SVRTGAYVTAGTRLTSVVPNHKWIIANLKETQLAHIRPGLPVTIRVDALDGKRFNGQVEF
ISPAAGSEFSAISPDNATGNFVKIAQRIPVRIRINEQDMQQLRPGMSVEVDIDTAAQAAD
EGAQ