Protein Info for IAI47_12395 in Pantoea sp. MT58

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 10 to 453 (444 residues), 356.2 bits, see alignment E=1.4e-110 PF02321: OEP" amino acids 57 to 244 (188 residues), 98.2 bits, see alignment E=2.6e-32 amino acids 269 to 451 (183 residues), 69.1 bits, see alignment E=2.2e-23

Best Hits

KEGG orthology group: None (inferred from 93% identity to pva:Pvag_0830)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>IAI47_12395 efflux transporter outer membrane subunit (Pantoea sp. MT58)
MRRGLLVSALMLALTGCATQVEKAPSSLPIPAAWRNSVGPAAAPEAEWWRAFHDAYLNRL
VTQALRNNPDILTARSRVDQYRAQLRATQGDEFPTLSAGVAATRERTLSSVTGQPYETDV
FQGLLQANYEVDLWGARSNSVSASQASLAAQQAAASAAELTIASSVASGYLNLCALDEQL
RVTEATLATRNNSLKLAQRQFESGYTSRLEWMQAASEYQSAKAQIPQLQHQIAQQENALS
ILVGMNPRSIARRQQFDQILPQQMPSLLPSELLNRRPDIVQAQRQLLAADASLASSRAKL
LPGLNLTATGTLQSSVLHQLADNPFRLWSVGGSILAPLLNREALTAQVDVSMATRNQALY
GYEKVVRNAFSEVNDALDAIRQREAQLQELQKQETYVTEALRIARNRYQNGYASYLDELD
AQRTLFSTQLNRVAVKNNLLLAQIDLYRALGGGWAPASTQ