Protein Info for IAI47_12290 in Pantoea sp. MT58

Annotation: phospholipase D family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to CLSC_ECOLI: Cardiolipin synthase C (clsC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to pva:Pvag_0851)

MetaCyc: 66% identical to cardiolipin synthase C (Escherichia coli K-12 substr. MG1655)
RXN0-7012 [EC: 2.7.8.41]

Predicted SEED Role

"Hypothetical protein YmdC, PLD phosphodiesterase domains"

MetaCyc Pathways

superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
cardiolipin biosynthesis I (3/3 steps found)
cardiolipin biosynthesis II (3/3 steps found)
cardiolipin biosynthesis III (3/3 steps found)
cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>IAI47_12290 phospholipase D family protein (Pantoea sp. MT58)
MTEAFELSPSLERSSWLKTQLEPECLRHPGLSGVHQLSDGLDAFAARYLLIQKAERSLDI
QYYIWQNDLSGRLLFSAVLEAARRGVKVRLLLDDNNTPGLDDTLAQLNRHPNIEVRLFNP
FSFRTLRALGYLTDFARLNRRMHNKSFTVDGVTTVVGGRNIGDEYFGTGNEPLFADLDVM
AIGPVVKEVAEDFERYWRSKPVSKLQQVLDEEESEEDSVSLPAEWRHSEPVQRYLQRLEN
SSLLQELEEGTLALTWAKARLLSDDPRKGLGKARARSLLPQRMLEVIGTPQEQFDIISAY
FVPTRAGVAQLLALKRKGVKIAILTNSLAANDVSIVHAGYAKWRKKLLRHGIALYELKPQ
AGVPDAPHDRGLTGNSGSSLHAKTFSVDQQTLFIGSFNFDPRSAVLNTEMGLVIESAALA
AETHQRFSHSMRDRAWTLRLDKWGRVNWLEYPDEPQQIVHKHEPGCSWWQRLQVRLVWRL
PIEWLL