Protein Info for IAI47_12170 in Pantoea sp. MT58

Annotation: flagellar basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17656: ChapFlgA_N
  • amino acids 25 to 93 (69 residues), 34.7 bits, E=2.7e-12
• TIGR03170: flagella basal body P-ring formation protein FlgA
  • amino acids 84 to 217 (134 residues), 126.3 bits, E=4e-41
• PF08666: SAF
  • amino acids 97 to 157 (61 residues), 32.2 bits, E=1.9e-11
• PF13144: ChapFlgA
  • amino acids 97 to 216 (120 residues), 97.4 bits, E=9.9e-32

Best Hits

Swiss-Prot: 50% identical to FLGA_ECOLI: Flagella basal body P-ring formation protein FlgA (flgA) from Escherichia coli (strain K12)

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 96% identity to pva:Pvag_0874)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Protein Sequence (219 amino acids)

>IAI47_12170 flagellar basal body P-ring formation protein FlgA (Pantoea sp. MT58)
MRRYLTLLTSLLVVIALPASAGDLNAQLNQFFKARDAQHAAGMVVVVRTPKEQWPACEAP
QFTLPGNSRLWGNMSVAANCGENRRYIQVQVQVTGSYLVANRLLSQGSSVSESDFTLQTG
RLDTLPARALLNADSVADAVVLRDIQPGQPINPSTLRQPWRVKAGQNVMVIASGDGFDAS
GEGKALNNAARSQSVRVRMGNGQVVSGKVREDGNILITL