Protein Info for IAI47_12125 in Pantoea sp. MT58

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 11 to 301 (291 residues), 371.9 bits, see alignment E=1.7e-115 PF10135: Rod-binding" amino acids 49 to 95 (47 residues), 60 bits, see alignment 2.6e-20 PF01832: Glucosaminidase" amino acids 166 to 302 (137 residues), 121.9 bits, see alignment E=2.5e-39

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 96% identity to pva:Pvag_0883)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>IAI47_12125 flagellar assembly peptidoglycan hydrolase FlgJ (Pantoea sp. MT58)
MADMQSLTSSAFDSRSLNELKRQASNDPKAHALQVARQVEGMFVQMMLKSMREALPQDGI
MGNEQTKLFTSMYDQQIAQEMGKRGLGLAETIVKQMQPATAPDEKAGTVPMKLDNSFILS
TSGAKPMAAEQLEQIVRKAMPRLPPVASPTGLPSDSREFIAQLTQPAQAASQQSGIPHHL
ILAQAALESGWGQRQILTRDGKPSYNVFGIKASGDWKGDTTDIMTTEYEQGEAKKVRASF
RVYNSYFEALTDYVKLLTKNPRYAAVTNATSAEQGAQALQAAGYATDPKYAQKLVGMIQQ
FKSMGDKVVKAYSQDMGDLF