Protein Info for IAI47_11935 in Pantoea sp. MT58

Annotation: two-component system sensor histidine kinase PhoQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 39 (6 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details PF08918: PhoQ_Sensor" amino acids 9 to 186 (178 residues), 282.6 bits, see alignment E=2.8e-88 PF00512: HisKA" amino acids 268 to 328 (61 residues), 27.7 bits, see alignment E=4.6e-10 PF02518: HATPase_c" amino acids 374 to 478 (105 residues), 62.3 bits, see alignment E=1.1e-20 PF14501: HATPase_c_5" amino acids 376 to 461 (86 residues), 28.5 bits, see alignment E=2.5e-10

Best Hits

Swiss-Prot: 63% identical to PHOQ_SALTI: Virulence sensor histidine kinase PhoQ (phoQ) from Salmonella typhi

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 98% identity to pva:Pvag_0933)

MetaCyc: 64% identical to sensor histidine kinase PhoQ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>IAI47_11935 two-component system sensor histidine kinase PhoQ (Pantoea sp. MT58)
MSWFNRYRPISLRARFLLASAAIVLFLSLSYGMVAVIGYVVSFDKNTYRVMRGESNLFFT
LAQWHDNTLTIAQPERMTLNFPTLVFIYDEHGKLLWQQRDVPEIRKKIRREWLLKPDFYE
IDTSNRTSMVAMGNNVNAKQRLNDWDTDSNDTFTHSVAVNRYDATTNLPALTIVVVDSIP
QELQHSDVVWSWFSYVLAANLILIIPLLWLAAHWSLRPIGALTQQVRELETSQRENLADN
PPQELRSLVRNLNLLLTNERQRYTRYRTTLSDLTHSLKTPLAVLQSTLRSLRNGKELTIE
QAEPVMLEQISRISQQVGYYLHRASMQADHNPLQRDIHSVSGLLDSLCSALNKVYQRKGV
AISLDISPELTFVGDQNDFMEVLGNVLDNACKYCLEFIEVSAYQSENALHLYIDDDGPGI
PESKRDLVFVRGQRADTLRPGQGLGLAVVRDILEQYEGNVIASSSALGGTRMEVVFQRQE
VEHRRE