Protein Info for IAI47_11905 in Pantoea sp. MT58

Annotation: 23S rRNA pseudouridine(2457) synthase RluE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00849: PseudoU_synth_2" amino acids 44 to 189 (146 residues), 61 bits, see alignment E=7.8e-21 TIGR00093: pseudouridine synthase" amino acids 48 to 219 (172 residues), 191.9 bits, see alignment E=3.1e-61

Best Hits

Swiss-Prot: 71% identical to RLUE_ECOLI: Ribosomal large subunit pseudouridine synthase E (rluE) from Escherichia coli (strain K12)

KEGG orthology group: K06181, ribosomal large subunit pseudouridine synthase E [EC: 5.4.99.12] (inferred from 94% identity to pva:Pvag_0939)

MetaCyc: 71% identical to 23S rRNA pseudouridine2457 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11834 [EC: 5.4.99.20]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase E (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>IAI47_11905 23S rRNA pseudouridine(2457) synthase RluE (Pantoea sp. MT58)
MRRLSLTAKPMRKTTQRIHQDKRFSRPTRDARRPPARPAMPRRVILFNKPFDVLPQFTDE
AGRRTLKDFVSVAEVYAAGRLDRDSEGLMVLTNDGALQAALTQPGKRTGKVYYVQVEGEP
QEADLQPLRDGVNLKDGMTLPAGIEKVPEPQWLWPRQPPIRERKNIPTQWLKVTLYEGRN
RQVRRMTAHIGFPTLRLIRYAMGQYSLDDLAPGAWRELSNIAP