Protein Info for IAI47_11815 in Pantoea sp. MT58

Annotation: D-ribose ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 29 to 238 (210 residues), 62.7 bits, see alignment E=4e-21 PF13407: Peripla_BP_4" amino acids 30 to 284 (255 residues), 198.8 bits, see alignment E=1.2e-62

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 98% identity to pva:Pvag_1000)

MetaCyc: 48% identical to putative erythritol ABC transporter substrate-binding protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>IAI47_11815 D-ribose ABC transporter substrate-binding protein (Pantoea sp. MT58)
MTRPLIKLTLLASMIAFSATALAAEQGLLAIITPSHDNPFFKAEAEGALAKAKELGYATL
VASHDDDVNKQNQLIETAIARKAKAIILDNAGADATVGPVQKAKDAGIPVFLIDREINKT
GIAVAQIVSNNYQGAQLGAEKFAKLLGGKGDYIELLGKESDTNAGVRSQGYHDVLDDYTD
MKMVAQQSANWSQTEAFSRMETLLQKHPNIVGVISGNDTMALGAEAALKAAGKTSVIVVG
FDGSDYTRDSILNKGNIKATVLQPGWDQAQMAVSQADYYLKNGKAQKQEKQLMDCVLIDE
SNAAKLKNFNLAK