Protein Info for IAI47_11800 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 51 to 80 (30 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 106 to 134 (29 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 340 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 338 (276 residues), 151.4 bits, see alignment E=1.4e-48

Best Hits

Swiss-Prot: 39% identical to RBSC_ECOLI: Ribose import permease protein RbsC (rbsC) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to pva:Pvag_1003)

MetaCyc: 49% identical to putative erythritol ABC transporter membrane protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>IAI47_11800 ABC transporter permease (Pantoea sp. MT58)
MKSNNSVALNTLPAKAFSSRESILLLLLKLRTFIALILIVGFFAITVPDFLATGSLVIMV
KHIAINAFLALGITFVIITAGIDLSIGATLGLCGMIAGWLITKGIVLPMFGIAIFPSVWV
IVPIVLLIGALIGAGNGWIITRYNVAPFICTLGTMYILRGAAMLTSGGETFPGLQGNPLL
GNTGFDRIGAGTFLGLPYAIWMMVVLALVIAYIARRLPFGRQVYAIGDNERAAELSGVKT
RQVKILVYTLSGFCAAIAGIVVSSQLVASHPANGTAFEMNAIAAVVLGGTSLAGGRGTIV
GTLIGAFVIGFLADGLIMMGVSEFWQMVIKGIVIIIAVIIDQTQSRMQQKAAVVAQKALI
EEGEPAKS