Protein Info for IAI47_11720 in Pantoea sp. MT58

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF00892: EamA" amino acids 7 to 130 (124 residues), 73.7 bits, see alignment E=1.7e-24 amino acids 139 to 275 (137 residues), 60.4 bits, see alignment E=2.2e-20

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_1017)

Predicted SEED Role

"Permease of the drug/metabolite transporter superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>IAI47_11720 EamA family transporter (Pantoea sp. MT58)
MAVRHFFLILMVVSIWAFNNVAVKWGLLELPPLFLTFMRFVVVAIVLVPFCRINRQQLRW
LLLLAFTFGFMHFSLLFVGLRYTDAGTGAIVVQLGTPIAMLLAMVVLKEKLKLVQLLGIM
ISLSGVVVLSGSPTIPSWWVLCLLLCSATGWAVSNLIVKKSPPIKPLTMTGWIAFLAIPI
TGASSFVMESNQLYALQHAGWHGWFAILYSAIASSIVAYTLWYMLLKKYNVNLIMPYSLL
TPVLSVLMGIVVLGDSLNSFKIIGASLVILGTAIAVINLRNLRMHARFPRLRRR