Protein Info for IAI47_11595 in Pantoea sp. MT58

Annotation: type VI secretion system baseplate subunit TssE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR03357: type VI secretion system lysozyme-like protein" amino acids 36 to 186 (151 residues), 60.4 bits, see alignment E=6.9e-21 PF04965: GPW_gp25" amino acids 63 to 167 (105 residues), 66.5 bits, see alignment E=7.8e-23

Best Hits

KEGG orthology group: K11897, type VI secretion system protein ImpF (inferred from 99% identity to pva:Pvag_1039)

Predicted SEED Role

"Uncharacterized protein ImpF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>IAI47_11595 type VI secretion system baseplate subunit TssE (Pantoea sp. MT58)
MSHDSGAHNDGYAQLHGGFRARKKRDALTARDKLQSSLLDRLTDNAPDKQQEAENSMLIS
HSTLRRHVLRDLQWLFNTINNEAQQDLSGFDQVQRSVWNFGVAPLAGQNVSDIEWQDMQR
KMTNAILHFEPRILPQGLQVRCVSDLGSLSLHNVLSIEIKGRLWCVPYPLAFLFRTQVDL
ESGHFELQDAG