Protein Info for IAI47_11580 in Pantoea sp. MT58

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 14 to 857 (844 residues), 1272 bits, see alignment E=0 PF02861: Clp_N" amino acids 28 to 75 (48 residues), 23.6 bits, see alignment 2.5e-08 PF00004: AAA" amino acids 224 to 356 (133 residues), 36.4 bits, see alignment E=3.6e-12 amino acids 606 to 690 (85 residues), 30.9 bits, see alignment E=1.9e-10 PF17871: AAA_lid_9" amino acids 364 to 454 (91 residues), 94.1 bits, see alignment E=2.5e-30 PF07724: AAA_2" amino acids 600 to 765 (166 residues), 185.2 bits, see alignment E=5.4e-58 PF07728: AAA_5" amino acids 605 to 726 (122 residues), 32 bits, see alignment E=6.3e-11 PF10431: ClpB_D2-small" amino acids 773 to 848 (76 residues), 51.7 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 98% identity to pva:Pvag_1042)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (869 amino acids)

>IAI47_11580 type VI secretion system ATPase TssH (Pantoea sp. MT58)
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVITHF
SLDEKALTQDIVAALDRLPRGASAVSDLSEHIDSAVERAWVYASLKYGATRIRGGHLLIG
MLKTFNLASVLKGISGQFSRVNADALLADFDTLLSNSKEAQQAMSAPADAAGAPPAAGGT
TLEQYGQDLTARAREGRIDPVTGRDDEIRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGL
ALRIAAGDVPAPLRDVQLWLLDIGLLQAGAGMKGEFEARLQALINEVQSSPTPIVLFVDE
IHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALTRRFQTVQVQ
EPDEAKAILMLRSTVSALEKHHRVLLLDDAVTAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQGAQPAALEDCLHRLAALEIEAEIIEREIRVGLGDVTRQQAIAAERTALETERDA
LQQRWLQERELVETLIALRARCVTEEDPALREQRDATQQQLTALQGDSPLLFAAVDAGVV
AAVVSDWTGIPLGRMVKNEIDAVLNLADTLNQRVIGQRHGLELIAKRVRTTRARLDNPNK
PAGVFMLCGPSGVGKTETALALAESLYGGEQNIITINMSEFQEAHTVSTLKGAPPGYVGY
GEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDKGWMEDGEGRHIDFRNTIIIL
TSNVGTQLISAMCADPELMPDPDALSTALRKPLLEVFPPALLGRLLVVPYYPLSDEMLAE
IVRLQLARIVRRLADNHGIEAQIDESVVSQIVQRCTEVESGGRMVDAILTNTLLPQMSQI
LLSAHARDERYRRVEVRCEQGEFVCQFAV