Protein Info for IAI47_11570 in Pantoea sp. MT58

Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 TIGR03361: type VI secretion system Vgr family protein" amino acids 5 to 521 (517 residues), 588.7 bits, see alignment E=9.5e-181 TIGR01646: Rhs element Vgr protein" amino acids 18 to 504 (487 residues), 447.8 bits, see alignment E=5.6e-138 PF05954: Phage_GPD" amino acids 22 to 330 (309 residues), 295.7 bits, see alignment E=6.1e-92 PF04717: Phage_base_V" amino acids 385 to 452 (68 residues), 52 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 81% identity to pao:Pat9b_2501)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>IAI47_11570 type VI secretion system tip protein VgrG (Pantoea sp. MT58)
MFSRITAQLPADGLLFHTLTGTETLSRPFVLTAELLATDARIDRHALLGKPVTFTLPTDG
LMNALSPRYLNGKITRVAVRSQELSGTRYAVYQLTVEPDLWPMQRDRNLRIFQSQTVPQI
VQTLLKEYAVSVETRLAGNYRVWEYCVQYQESSLDFISRLMELEGIYYFFRHEADKHTLV
LCDAPDQHQAFPGYETIAYHVTPSGGVVTEEGISQWSLAESVTPGIYSTDDYDFRKPNAW
MLQARQNPASPVPGSVDVYDWPGHFVDHSHGESYARIRQEVWQAEHHSVSGSGTATGIAP
GFTFAIINAPHFSDNGEYLVTSATYDFAENSYASGDTSDSRHNISFTVLPSSVTYRTPPE
TPWPKTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTA
DTANALRFEDKAGEEHLWIQAQKNMDTHVKNDESHSVGGSQTVSINRDYKGKVAGAHEQA
TQLSHTEVIGGGFLQLVQGGIVQASDTGIRLVAGQSILELGANGQVNLQCINFTVNASGQ
GEINTGGTLDLNISKPAAASDTEPTSAQIQNAVKAAFNQGSKE