Protein Info for IAI47_11345 in Pantoea sp. MT58

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 PF00005: ABC_tran" amino acids 39 to 203 (165 residues), 103.1 bits, see alignment E=7.1e-33 amino acids 344 to 495 (152 residues), 112.2 bits, see alignment E=1.1e-35 PF08352: oligo_HPY" amino acids 254 to 286 (33 residues), 28 bits, see alignment (E = 7.9e-10) amino acids 547 to 580 (34 residues), 35.2 bits, see alignment (E = 4.5e-12)

Best Hits

Swiss-Prot: 56% identical to GSIA_SALCH: Glutathione import ATP-binding protein GsiA (gsiA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K13892, glutathione transport system ATP-binding protein (inferred from 95% identity to pva:Pvag_1054)

MetaCyc: 56% identical to glutathione ABC transporter ATP binding subunit GsiA (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>IAI47_11345 ABC transporter ATP-binding protein (Pantoea sp. MT58)
MTDTQRTSPATRAALPSPVLAIQDLSVSFHGRSGENQALKGISFAIHPGEIVAVVGESGS
GKSVTSLAVMGLLANNGCIDRGSMQFCDRSGNVHALETLDDAQRRTLRGREMAMIFQEPM
TSLNPVLRVDDQLTEALRDHHLCDKKQAHARVRELLRQVRIADVDRVMKSYPHSLSGGMR
QRVMIAQALACDPQLLIADEPTTALDVTVQARILHILRDLQREKQMAVLFITHDMGVVAE
IADRVVVMLRGEVVEQGTVSEIFAGPKHAYTQALLAAVPKLGDMREHVWPQRFPLPGARE
AVQSEQQTARYDVAPLLDVRGLKVYYPIRSGIFSSLTHHVHAVEQIDFSLWPGETLAIVG
ESGCGKSTTGRALMRLINSEAESIHFEGKEISDLKEAAFQPLRREIQMVFQDPYASLNPR
LTVGFTIAEPLLLHGMVSSLEQASPQIDALLKSVGLLPEHARRYPHEFSGGQRQRIAIAR
AMALKPKVIIADEAVSALDVSIQAQVVNLMMDLQQQTGVAWIFISHDMAVVERIANRVAV
MYLGQIVELGPRQSVFNQPQHPYTQRLLASVPVADPENRQPRLFDDSEIPSPLRKVGETV
TKPRYRQVAPQHWVADGIAL