Protein Info for IAI47_11330 in Pantoea sp. MT58

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF12911: OppC_N" amino acids 16 to 68 (53 residues), 58.1 bits, see alignment 6.5e-20 PF00528: BPD_transp_1" amino acids 109 to 293 (185 residues), 94.9 bits, see alignment E=5.2e-31

Best Hits

Swiss-Prot: 59% identical to GSID_SALPA: Glutathione transport system permease protein GsiD (gsiD) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 96% identity to pam:PANA_4045)

MetaCyc: 59% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>IAI47_11330 ABC transporter permease subunit (Pantoea sp. MT58)
MSSQLLTDNPPQIIRSPWRDFLHAFVRNPLALVSGGFVLLLIVVAIFAPWLAPWDPMAPD
WMALSSPPTAAHWMGTDELGRDLLSRIIYGARISLYIGVLSVTIGMLVGVMFGLLAGYYG
GWVDMLIMRGADVLFAFPGMLLAIAVVALLGTGLNNVIIAVAVFSVPVFARIVRASTLSL
KQAAYVEAVRCAGAPDRVIILRHILPGTLSSVIVYFTMRIGTSILTAAGLSFIGLGPEPD
VPEWGNILAMSRSMMMAGSWHMSVFPGLAIFITVLAFNLLGDALRDTLDPKLKG