Protein Info for IAI47_11290 in Pantoea sp. MT58

Annotation: ribose-phosphate diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR01251: ribose-phosphate diphosphokinase" amino acids 4 to 314 (311 residues), 419.9 bits, see alignment E=2.5e-130 PF13793: Pribosyltran_N" amino acids 4 to 121 (118 residues), 175.7 bits, see alignment E=4.1e-56 PF00156: Pribosyltran" amino acids 158 to 249 (92 residues), 72.1 bits, see alignment E=4.9e-24 PF14572: Pribosyl_synth" amino acids 204 to 313 (110 residues), 103.8 bits, see alignment E=1.7e-33

Best Hits

Swiss-Prot: 97% identical to KPRS_ECO57: Ribose-phosphate pyrophosphokinase (prs) from Escherichia coli O157:H7

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 99% identity to pam:PANA_1638)

MetaCyc: 97% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>IAI47_11290 ribose-phosphate diphosphokinase (Pantoea sp. MT58)
MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC
APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMMQIGLENPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERG
AKRVFAYATHPIFSGNAVENLRKSVLDQVIVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI
RRISNEESISAMFEH