Protein Info for IAI47_11150 in Pantoea sp. MT58

Annotation: D-threitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00106: adh_short" amino acids 22 to 214 (193 residues), 171.6 bits, see alignment E=2.1e-54 PF08659: KR" amino acids 25 to 176 (152 residues), 44.7 bits, see alignment E=2.2e-15 PF13561: adh_short_C2" amino acids 32 to 263 (232 residues), 213.5 bits, see alignment E=5e-67

Best Hits

Swiss-Prot: 51% identical to DTHD_MYCS2: D-threitol dehydrogenase (dthD) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_1100)

MetaCyc: 51% identical to D-threitol dehydrogenase (Mycolicibacterium smegmatis)
ERYTHRULOSE-REDUCTASE-RXN [EC: 1.1.1.403]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.403

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>IAI47_11150 D-threitol dehydrogenase (Pantoea sp. MT58)
MSGEYDVNLRYGVDTAMNLADKVAVVTGGLGGIAMATNGMLLEKGARLALLYPPFEAEKV
ASLQAEFAADRVQFVCCDVTDPASVEEAFDAVVSHYGRIDILVNCAGYVMLQPVIETDFA
EWQKQIAVNLTGPFLCSQAAAKLMIRAGAGGKIINIASQAASIAIDNHVAYTSAKAGLLG
MTKVMAKEFAPHRINVNTLSPTVVLTPMGEKAWRGEKGEQMKKLIPLGRFAYTDEIAAAV
LFFASNGSDMITGADLMIDGGFTIW