Protein Info for IAI47_10945 in Pantoea sp. MT58

Annotation: vitamin B12 ABC transporter permease BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF01032: FecCD" amino acids 26 to 324 (299 residues), 271.4 bits, see alignment E=4.7e-85

Best Hits

Swiss-Prot: 70% identical to BTUC_SALNS: Vitamin B12 import system permease protein BtuC (btuC) from Salmonella newport (strain SL254)

KEGG orthology group: K06073, vitamin B12 transport system permease protein (inferred from 97% identity to pva:Pvag_1142)

MetaCyc: 70% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>IAI47_10945 vitamin B12 ABC transporter permease BtuC (Pantoea sp. MT58)
MSLLDTFARQSDQRGQKWLSALALTLCALLCLSLCAGDSWIAPAAWFTESGRLFVWQLRL
PRSLAVVLVGASLAICGVVMQALFTNPLAEPGLLGVSNGAGIGLVLGVLLGSGSLWSLGL
AAMAGALIITLILLHFAHRQLSVTRLLLTGVALGIICSAIMTWAVYFSTSLDLRQLMYWM
MGGFSGIDWRYGWMMLALLPVMLALGATGPILNLLALGETSARQLGLSLFYWRNLLVLAM
GWLVGISVAMAGAIGFVGLVIPHLLRLSGISDHRYLLPASALAGAAVLLAADIVARLALT
SAELPIGVVTATLGAPLFIILLVKSSR