Protein Info for IAI47_10895 in Pantoea sp. MT58

Annotation: AI-2E family transporter YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 53 (17 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 123 to 139 (17 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 241 to 270 (30 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 306 to 333 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 343 (329 residues), 173.1 bits, see alignment E=4.4e-55

Best Hits

Swiss-Prot: 70% identical to YDIK_ECOLI: Putative transport protein YdiK (ydiK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_1151)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>IAI47_10895 AI-2E family transporter YdiK (Pantoea sp. MT58)
MKSQYRDMDLPQILFTLMFILLLIVACLWVVQPFILGFAWASMVVIATWPLMLKFQRLLW
GRRSLAVIVMTLLLLLLFIIPIALLVSSLIDNSAPVIAWVTQGHTMPKLTWLREIPMVGK
KLYVSYDTLVASGGAGVMAKIQPYIGRTTGFFVAQAGHFGRFMIHLGVMLLFSVLLYWRG
EQAAQGIRHFAFRMAGRRGDAAVLLAAQSIRAVALGVVVTALVQGVLGGIGLAISGIPYA
TLLTVLMILCCLVQLGPLLVLVPAIIYLYWSGDTTWGTVLLVWSCVVGTMDNVLRPMLIR
MGADLPMILILSGVIGGLFAFGMIGLFIGPVVLAVSYRLVSVWVHEAPAPDKDPMASADA
LADHEGTPPAV