Protein Info for IAI47_10815 in Pantoea sp. MT58

Annotation: riboflavin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 202 (202 residues), 269.3 bits, E=7.2e-85
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 80.3 bits, E=4.4e-27
  • amino acids 100 to 185 (86 residues), 82 bits, E=1.3e-27

Best Hits

Swiss-Prot: 75% identical to RISA_SHIFL: Riboflavin synthase (ribE) from Shigella flexneri

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 96% identity to pva:Pvag_1167)

MetaCyc: 75% identical to riboflavin synthase (Escherichia coli K-12 substr. MG1655)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Protein Sequence (219 amino acids)

>IAI47_10815 riboflavin synthase (Pantoea sp. MT58)
MFTGIVQGTAEIVSIEEKELFRTHTVRLPDALLPGLALGASVAHNGCCLTVTAIDGDCVS
FDLIKETLRVTNLGDLRQGDVVNIERAARFSDEIGGHLMSGHIMTTAEICRIIQSEHNRE
VWFKIQDPTQMKYILHKGFVGIDGISLTVGDVTKTKFCVYLIPETLERTTLGAKTFGDRV
NIEIDPHTQAIVETVERVLAQRDAAAAMSMLTGQTDAES