Protein Info for IAI47_10760 in Pantoea sp. MT58

Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF00440: TetR_N" amino acids 15 to 56 (42 residues), 35.3 bits, see alignment 7.9e-13 PF16925: TetR_C_13" amino acids 82 to 190 (109 residues), 51.4 bits, see alignment E=9.8e-18

Best Hits

Swiss-Prot: 53% identical to NEMR_ECOL6: HTH-type transcriptional repressor NemR (nemR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_1178)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>IAI47_10760 TetR/AcrR family transcriptional regulator (Pantoea sp. MT58)
MNKTLQRNETREHLLQTGETLCLQRGFAGMGLSELLTQAAVPKGSFYYYFRSKEAFGVAL
LERYFARFLQDVELQLNQTSGTPRERLLNHFRAAVELFVQQGHIMGCLGVKISAEVCDLS
EPMRDALQQGAAKITALYARTLIAAEQQESMNLPQPPAQMAELLSLLWLGASLQSKISRE
AQPLRLALSTIEQWLKSH