Protein Info for IAI47_10735 in Pantoea sp. MT58

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 438 to 456 (19 residues), see Phobius details amino acids 464 to 482 (19 residues), see Phobius details amino acids 494 to 512 (19 residues), see Phobius details PF04632: FUSC" amino acids 20 to 663 (644 residues), 516.3 bits, see alignment E=2.3e-158 PF06081: ArAE_1" amino acids 26 to 108 (83 residues), 22.1 bits, see alignment E=2.2e-08 PF13515: FUSC_2" amino acids 33 to 163 (131 residues), 51.8 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_1183)

Predicted SEED Role

"FIG01045166: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>IAI47_10735 FUSC family protein (Pantoea sp. MT58)
MNVQWLAWDQLPWIKANRGQWRYALRNAIAMCLALSIAYGLDLDEPYWAMTSAAVISFPT
VGGAISKSLGRIVGSLLGATAALLIAGHTLNEPWLFTFAIAGWLALCTGISNHYQNNVAY
AFSLAGYTAAIIAFSSVNITDITTLWTIAQARVCEVISGILCAGLMMMVLPSTSDGEALI
TSLKQMHARLLEHAVLLLQPSASDTIRVAHENVISQILTMNLLRIQAFWSHYRFRRQNNV
LNYVLHQQLRLTSVLSSLRRMLLNWPDAPEPLFEALQRLLAELAKPACDKYRLAQILRSV
TPGADGDYRQRAFCQRLRYFCWMYLNVLRWIRLLDRADADTRFQPPPVPALARDSDSAEA
GWSALRTFCVIVLGCAFWINTQWSSGASALTLTAIACVLYASVPSPGGSVTLLLKTLLWL
FAFSFVMKFGLMVQISQLWPFLLFLFPLLVTLQLFKLQQKQRAGMWGQFIVFMGSFIAVT
NPPTWDYQDFFNDNIAKVCGVLLAWLAFQILRPSSDARRSRRHIRALRLAFLDQLRQRPR
LSESRFESQIYHRISQLSHSRDEQARTWLLRWGVVLLNCSHIVWQLREWRAGSAALTGFR
DSSLHNLQQIISSRGVRHSSLDQMLRELEESITALLALENNEASELAGIIWRLRCSLAQL
KQAVPA