Protein Info for IAI47_10710 in Pantoea sp. MT58

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03702: AnmK
  • amino acids 5 to 367 (363 residues), 563.2 bits, E=1.3e-173

Best Hits

Swiss-Prot: 78% identical to ANMK_ERWT9: Anhydro-N-acetylmuramic acid kinase (anmK) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 95% identity to pva:Pvag_1188)

MetaCyc: 76% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• peptidoglycan recycling II (7/10 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Protein Sequence (373 amino acids)

>IAI47_10710 anhydro-N-acetylmuramic acid kinase (Pantoea sp. MT58)
MKSGRYIGVMSGTSLDGVDVVLAAIDENMVAQQASYCHPMPAALRQAILGVCQGQTLTLS
QLGQLDTRLGQLFAEAVVTLMKREALEASDITAIGCHGQTVWHEPQSDAPNTLQIGDNNQ
IVAATGVTVVGDFRRRDMALGGQGAPLVPAFHQALLMDATERRMVLNIGGIANLSLLIPG
QPVRGFDTGPGNMLLDAWIWRNQGQPYDKDAQWARSGTVIQPLLEALLREPWFALPPPKS
TGREHFNLGWLEQHLRYFPGLAPQDVQATLVELSAITITQQVLLNDGCDRLLVCGGGSRN
PQLMARLAAHLPGTEVTPTDAAGISGDDMEALAFAWLAFRTLSGLPGNLPAVTGAREKSV
IGAIYPANSLYRR