Protein Info for IAI47_10665 in Pantoea sp. MT58

Annotation: glycogen debranching protein GlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 TIGR02100: glycogen debranching enzyme GlgX" amino acids 12 to 689 (678 residues), 1054.7 bits, see alignment E=0 PF02922: CBM_48" amino acids 17 to 104 (88 residues), 68.9 bits, see alignment E=3.9e-23 PF00128: Alpha-amylase" amino acids 189 to 286 (98 residues), 31.8 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 53% identical to GLGX_MYCTO: Glycogen operon protein GlgX homolog (glgX) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 99% identity to pva:Pvag_1197)

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>IAI47_10665 glycogen debranching protein GlgX (Pantoea sp. MT58)
MSNSQRFEITAGYSHLLGANFDGQGVNFALFSAHAERVELCLYDPSGKTEIARLELPEYT
HEVWHGYIPGLKPGALYGYRVYGPYDPENGHRFNPNKLLLDPYARELAGDIAWNEAHFAY
DLYHDDKDLTFDTRDSAPFTPKCRVIDPNEFDWHDQNRPNVPWPKTVIYETHVKGFTQLN
TALPPEMRGTFDGMSHKSTVNYIKSLGITSVELLPVHWFPDDQHLLDKGLKNFWGYNTLG
FFAPATRYFGPRGIQGFRDMVRAFHDAGIEVILDVVYNHTAEGNELGPTLSFKGIDNFSY
YRTMPDQHRYYINDTGTGNTVNTSHPRVLQMVLDSLRYWSESMHIDGFRFDLGTILGREP
DGFDPRGGFFDAIMQDPILSQKKLIGEPWDIGPGGYQVGSFPPGWAEWNDQYRDTVRDYW
KGNNVSTDFAARLLGSGDLYDQHGRRPWASVNFITAHDGFTLNDLVSYNDKHNDENGEDN
NDGHNDNRSYNYGVEGPTDDEGINAVRERQKRNFLATLIFSHGTPMLLAGDEFGRSQMGN
NNGYCQDSEISWVHWDNLPESAEALREFTRQILTLRAQQPLLRRENWRDGMDIKWFNAGG
GFQQSEQWDEGSTLGVYIGRPDLQTEEGIWHDVLMLLNPFEGNVPFRIPQFGEGGWVLEL
TTSDTAKRGLVITKEKDFELEGRSFALFRRP