Protein Info for IAI47_10570 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 40 to 40 (1 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 346 (26 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 369 (343 residues), 82.1 bits, see alignment E=3.7e-27 PF00083: Sugar_tr" amino acids 48 to 201 (154 residues), 30.2 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: None (inferred from 59% identity to asa:ASA_3608)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>IAI47_10570 MFS transporter (Pantoea sp. MT58)
MSEVLTIDSRPTDKKNSASKKSVLFFLALALVAALLNSSAPTPLYPLYQQQLGLTAVSLT
IIYGAYAAGVLIALFSVGNLAGKVADLRSLMMPALLAVFAGALLFSLADSFACLFMARLL
AGVGTGALTGAANIALLRFGPKDGGKAAALLATLSFTTGLALGPVFSGVAIQTNFHSQTL
PFLLIMITAAIALIGLRFSWPARHHDQPKAAPSSSAISAGTTLKAGLKATGIRFFLCAGA
LFMSWAFAASILSIGPAVSEHLLGIHSQGVYGYVIAVYLMVAGISQILSRRISARTSLAA
GCLTQAISIVFFTWAISTHSLVWACTGLLVAGYSYGAIFVGSATLLNMISPAASHAKLIS
LFYVIAYIANWVPVLLGAVVDHASLNLAVDLLFSVGAVICLLLSIAVFWIKMEKRD