Protein Info for IAI47_10510 in Pantoea sp. MT58

Annotation: pyridoxal kinase PdxY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 1 to 286 (286 residues), 443.4 bits, E=1.9e-137
• PF08543: Phos_pyr_kin
  • amino acids 74 to 263 (190 residues), 60.4 bits, E=1.9e-20
• PF00294: PfkB
  • amino acids 135 to 249 (115 residues), 40.2 bits, E=2.8e-14

Best Hits

Swiss-Prot: 80% identical to PDXY_SALTY: Pyridoxal kinase PdxY (pdxY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 99% identity to pva:Pvag_1227)

MetaCyc: 79% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (7/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (286 amino acids)

>IAI47_10510 pyridoxal kinase PdxY (Pantoea sp. MT58)
MKNILAIQSHVVFGHAGNAAAEFPMRRLGANVWPLNTVQFSNHTQYGHWTGTVMPATHLT
DIVKGIADIDRLKTCDAVLSGYLGSAEQGEQILQIVRQVKAANPQAWYFCDPVMGHPEKG
CIVAPGVAEFHCKMAMPASDIIAPNLLELEMLSERTITDVDAAVDAARALIAQGPRVVLV
KHLARAGRRSDRFEMLLVTAEDAWHISRPLVDFGVRQPVGVGDLTSGLLLVNLLHGKSLQ
DALEHVTAAVYEVMLKTHEMGEYELQLVAAQDAIARPTQHFTAEKL