Protein Info for IAI47_10485 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 392 (364 residues), 138.8 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_1232)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>IAI47_10485 MFS transporter (Pantoea sp. MT58)
MDSALSPQQDELIASAIKKFFTHIIPMLVVMLIINQIDRANIGFIKAELRTDAGISAAAF
GLGAGLFFIGYALFEVPSNLMMKRFGARVWLTRIMITWGLVVVMTGFVTSPIQFYLLRFL
LGVAEAGFFPGVLFYFRQWVPNAWRGRATAMVLSATAGAFLFSGPITGAILMMHDFSGIA
GWKWVMFLEGGASVLVGILAAWVLVSRPGDARWLSDAEKQALIQQLNSEEAQRDELNRAP
GKMSLLRNRSLLFFCAIFFTMTMTGYTLVFWLPQIIQRIQGFSSFGIGILTAVPWLCAII
AINLLSRFSDRHRDKLDKALGVAMLVAACGTFMATLGSPWFGFLAMIVACIGSKVSATFF
WPMPQGELPASIVAPGIALVNSVGNLGGFFAPTVFGYLEMKTGSTTGGLYALTSVSLLTG
LWLLLRRKPSPPSLDPMENHNVRQSSH