Protein Info for IAI47_10450 in Pantoea sp. MT58

Annotation: electron transport complex subunit RsxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 1 to 191 (191 residues), 288 bits, see alignment E=1.4e-90 PF04060: FeS" amino acids 44 to 76 (33 residues), 43.5 bits, see alignment 8e-15 PF12837: Fer4_6" amino acids 110 to 132 (23 residues), 25.9 bits, see alignment (E = 2.7e-09) PF14697: Fer4_21" amino acids 110 to 164 (55 residues), 68.8 bits, see alignment E=1.4e-22 PF00037: Fer4" amino acids 111 to 132 (22 residues), 29 bits, see alignment (E = 2.8e-10) PF13237: Fer4_10" amino acids 112 to 158 (47 residues), 28.2 bits, see alignment E=6.2e-10

Best Hits

Swiss-Prot: 90% identical to RNFB_ERWT9: Ion-translocating oxidoreductase complex subunit B (rnfB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 98% identity to pva:Pvag_1239)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>IAI47_10450 electron transport complex subunit RsxB (Pantoea sp. MT58)
MTAIWIAVAVLSALSLVFGALLGYASRRFEVEEDPIVEQIDAILPQSQCGQCGYPGCRPY
ADAVGNNGEAINKCAPGGEQTMLKLAALLNVDPQPIDGDESAKEPVRTVAFIDEANCIGC
TKCIQACPVDAIVGATRAMHTVLSDVCTGCDLCVAPCPTDCIEMRPVATTPANWKWDLNT
IPVRVIPVDTHA