Protein Info for IAI47_10380 in Pantoea sp. MT58

Annotation: L-arabinose ABC transporter permease AraH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 316 (256 residues), 134.1 bits, see alignment E=2.7e-43

Best Hits

Swiss-Prot: 85% identical to ARAH_ECOLI: L-arabinose transport system permease protein AraH (araH) from Escherichia coli (strain K12)

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 99% identity to pva:Pvag_1253)

MetaCyc: 85% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>IAI47_10380 L-arabinose ABC transporter permease AraH (Pantoea sp. MT58)
MASSTTSNTPQPASRGGLQLGRIWDNFGMLVVFALLFIVCAIFVPNFGSFINMKGLGLAM
SMSGMVACGMLFCLASGDFDLSVASVIACAGVVTAVVINMTESLWIGVGAGLVLGMITGF
INGFVIARLKINALITTLATMQIVRGLAYIFSDGKAVGIEDERFFELGFANWLGVPAPIW
LTLATMVIFGFLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTRIIIFILSGLVSAAAGII
LASRMTSGQPMTSIGYELVVISACVLGGVSLKGGIGKISYVVAGVLILGTVENAMNLLNI
SPFSQYVVRGLILLAAVIFDRYKQKKA