Protein Info for IAI47_10375 in Pantoea sp. MT58

Annotation: arabinose operon transcriptional regulator AraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF02311: AraC_binding" amino acids 27 to 161 (135 residues), 87.5 bits, see alignment E=1e-28 PF12833: HTH_18" amino acids 204 to 283 (80 residues), 78.3 bits, see alignment E=6.8e-26 PF00165: HTH_AraC" amino acids 243 to 282 (40 residues), 39.2 bits, see alignment 8.5e-14

Best Hits

Swiss-Prot: 74% identical to ARAC_DICCH: Arabinose operon regulatory protein (araC) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 100% identity to pva:Pvag_1254)

Predicted SEED Role

"Arabinose operon regulatory protein" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>IAI47_10375 arabinose operon transcriptional regulator AraC (Pantoea sp. MT58)
MYHRELPAEQQNPLLPGYSFNAWLVAGLTPITADGPLDFFIDRPHGMKGYILNLTIKGKG
RVFDGERAFDCEPGEMLLFQPKTAHYYGRAPDSPQWFHRWVYFRPRAYWHDWLRWQDEQE
GVGRLLLPESLRGEFDRLFASIEQTHNSGRRFAEELAMNLLERLLLRAVEEDPRSHQLIR
DPRVIEACQYVTNHLASEVKIEEVARHVCLSPSRLAHLFREQMGVNLLRWREDQRVIRAK
LLLQTTQEPIASVGREVGYDDQLYFSRVFRKRVGVSPSDFRRRNQDAHDSLAAQTAWPLA
RSAIS