Protein Info for IAI47_10340 in Pantoea sp. MT58

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20511: PMI_typeI_cat
  • amino acids 1 to 149 (149 residues), 151.2 bits, E=4.3e-48
• TIGR00218: mannose-6-phosphate isomerase, class I
  • amino acids 2 to 383 (382 residues), 400 bits, E=5.3e-124
• PF20512: PMI_typeI_hel
  • amino acids 156 to 235 (80 residues), 46.6 bits, E=8e-16
• PF21621: MPI_cupin_dom
  • amino acids 310 to 388 (79 residues), 86.6 bits, E=1.9e-28

Best Hits

Swiss-Prot: 71% identical to MANA_ECOLI: Mannose-6-phosphate isomerase (manA) from Escherichia coli (strain K12)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 92% identity to pva:Pvag_1258)

MetaCyc: 71% identical to mannose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• D-mannose degradation I (2/2 steps found)
• D-mannose degradation II (2/2 steps found)
• mannitol degradation II (3/4 steps found)
• mannitol biosynthesis (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• GDP-mannose biosynthesis (2/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (1/3 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• β-(1,4)-mannan degradation (1/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Protein Sequence (391 amino acids)

>IAI47_10340 mannose-6-phosphate isomerase (Pantoea sp. MT58)
MQKMNNSLQNYAWGSKTALTELYGVENPKGLPMAELWMGAHPKSPSTVIDQGSERSLRDV
IDASPAAMLGDAVAQRFGELPFLFKVLCADQPLSIQVHPSKHAAEVGFARENAAGIPLAA
AERNYKDANHKPELVYALTAFQAMNGFRTLTQMVSLLEPVAGAHPQIAHFLQHPEKDTLA
ALFSTLLSLEGEAKSLALGVLKSALDVQQGEPWETIRMIAAEYPDDSGLFSPLLLNVITL
QPGEAMFLYAETPHAYLKGVALEVMANSDNVLRAGLTPKYIDIAELMANLKFDEKPANAL
LTAPEHQGNTLRFPIPVDDFAFAIHSLNAQPQSLAQQSAAIMFCIEGQAVIAKGEQQVTL
KPGESCFIAASESPVTAAGTGRLARVFNDLG