Protein Info for IAI47_10330 in Pantoea sp. MT58

Annotation: DNA replication terminus site-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF05472: Ter" amino acids 10 to 304 (295 residues), 403.2 bits, see alignment E=2.9e-125 TIGR02648: DNA replication terminus site-binding protein" amino acids 10 to 306 (297 residues), 439.1 bits, see alignment E=4.2e-136

Best Hits

Swiss-Prot: 58% identical to TUS_CITK8: DNA replication terminus site-binding protein (tus) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K10748, DNA replication terminus site-binding protein (inferred from 94% identity to pva:Pvag_1260)

Predicted SEED Role

"DNA replication terminus site-binding protein" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>IAI47_10330 DNA replication terminus site-binding protein (Pantoea sp. MT58)
MTRYDLVADMHQCVNDLELALGELRQLIEATPLLIARVFSLPPVVKGREHEAITRIAVEQ
HLGERALKMALDHYCRLFMQHQSEQLSTKAAVRLPGALCIECDAQQEAEIVSLVELINQL
KARLEQLITVDSGLPSEARFEFVHQHLRGLITLNAYRTITLLSAPDSLRFGWANKHIIKN
LRREEVIAQLEKSLKSGRAKAPWSREQWAEKVQEELASVRALPASARLKIKRPVKVQPVA
RVWRADEQKQTQLACPSPILVICRDRTQVPALGELLNYDADNITHRHKPAAEPLNLLIPR
LHLWVDCPL