Protein Info for IAI47_10305 in Pantoea sp. MT58

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 48 to 373 (326 residues), 272.3 bits, see alignment E=2.4e-85 PF16576: HlyD_D23" amino acids 64 to 291 (228 residues), 60.2 bits, see alignment E=2.8e-20 PF13533: Biotin_lipoyl_2" amino acids 65 to 113 (49 residues), 59.5 bits, see alignment 3.3e-20 PF13437: HlyD_3" amino acids 176 to 288 (113 residues), 29.5 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 35% identical to BEPF_BRUSU: Efflux pump periplasmic linker BepF (bepF) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_1265)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI47_10305 efflux RND transporter periplasmic adaptor subunit (Pantoea sp. MT58)
MITNRVRQGLTLLGMVLLITQLSGCDKGVAQNAPPPPPEVSAAPVLIKPVSQWDNFNGRV
EAVQSVQLRPRVSGYIDSVNYREGDEVKKGQVLFTIDDRSYRAALEQAKAELARARSQAS
LARSESGRSEKLIGTQAISREAWEQRRSAASQAQADVLAAEAAVDMAQLNLDFTRVTAPI
DGRASRAQITAGNLVTAGDSASVLTTLVSQQQMYVYFDVDENTFLNYQAMARQGQQRHAL
PVEIALVGEQGFPHQGKIDFTDNQLTASTGTIRMRALLDNQQRQFTPGLFARVRLPGSAQ
FEAVLIDDKAVLTDQDRKYVYVVDGEGKAQRRDIQPGAMIDGLRIVKSGLHAGDKVIIAG
LQKVFMPGMPVTAQQVAMRAAAAQ