Protein Info for IAI47_10270 in Pantoea sp. MT58

Annotation: benzoate/H(+) symporter BenE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 253 to 279 (27 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 352 to 384 (33 residues), see Phobius details PF03594: BenE" amino acids 9 to 383 (375 residues), 435.3 bits, see alignment E=9.5e-135 TIGR00843: benzoate transporter" amino acids 10 to 385 (376 residues), 435.2 bits, see alignment E=1.1e-134

Best Hits

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 92% identity to pva:Pvag_1272)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>IAI47_10270 benzoate/H(+) symporter BenE family transporter (Pantoea sp. MT58)
MTRAESSRFTLPMLVSGFVAVLVGYSSSGAIIYQMFQAAGASPAQIGGWLSVLGLAQGIV
SIGLSLRYRMPVLAAWSTPGAALLATSFHGISLNEAVGVFVFANLLIVVSGVTGLFARLM
NHIPASLAAAMLAGILLRFGLQTFADLQSNFVLCGSMCLAWLLARRWLTRYAILVTLLVG
VVIALAQHAIHFPQQSIMLALPEPVMPHFTLATQLGMGVPYFLVTMASQNAPGIATLQAH
GYRPPVSSLMSWTGLTGLLLSPFGGFSVCVAAITAAICMSDEVDENPQQRWRAAVLAGIF
YLLAGVSGALIAVLFSALPAVLIEALAGLALLATLGGSLHRALDVPAERDSALVTFLITA
SGVSLLGIGPAFWGLAGGIIAHLVLVRRTV