Protein Info for IAI47_10215 in Pantoea sp. MT58

Annotation: pyrroloquinoline-quinone synthase PqqC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 7 to 241 (235 residues), 393.1 bits, see alignment E=2.1e-122 PF03070: TENA_THI-4" amino acids 14 to 223 (210 residues), 225.4 bits, see alignment E=3.6e-71

Best Hits

Swiss-Prot: 90% identical to PQQC_KLEP3: Pyrroloquinoline-quinone synthase (pqqC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 99% identity to pva:Pvag_1284)

MetaCyc: 90% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

"Pyrroloquinoline-quinone synthase (EC 1.3.3.11)" (EC 1.3.3.11)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>IAI47_10215 pyrroloquinoline-quinone synthase PqqC (Pantoea sp. MT58)
MQITDTLSPQAFEQALRDKGAYYHIHHPYHIAMHNGQATREQIQGWVANRFYYQTTIPLK
DAAIMANCPDPATRRKWVQRILDHDGSNGEEGGIEAWLRLGEAVGLTREELLSEQHVLPG
VRFAVDAYINFARRANWQEAACSSLTELFAPQIHQSRLESWPQHYPWIKEEGYFYFRSRL
GQANRDVEHGLALALEYFTTAETQNRMLEILQFKLDILWSMLDAMTMAYELKRPPYHTVT
DKAAWHTTRLV