Protein Info for IAI47_10200 in Pantoea sp. MT58

Annotation: pyrroloquinoline quinone biosynthesis protein PqqF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 8 to 682 (675 residues), 655.1 bits, see alignment E=8.9e-201 PF00675: Peptidase_M16" amino acids 14 to 146 (133 residues), 101.6 bits, see alignment E=4e-33 PF05193: Peptidase_M16_C" amino acids 174 to 323 (150 residues), 39.6 bits, see alignment E=5.3e-14

Best Hits

KEGG orthology group: None (inferred from 83% identity to pva:Pvag_1287)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (758 amino acids)

>IAI47_10200 pyrroloquinoline quinone biosynthesis protein PqqF (Pantoea sp. MT58)
MKTRGLVINGLMIELVHQADASQAAALIQVGAGSHDEPERWPGLAHLLEHLLFTGSSGWP
DEGRLMSWIQTQGGKVNATTLARRSAFFFEVTPSLLAEGLARLQDMLVSPLLDNQAIAQE
VAVIDAEYQLLQRHEPSRIEAALLHAALSPAEFQRFHIGSRASFGDEMSALQRALRQFHQ
RYYFASNMRLWLQGPQSLDELEQLARQFASALPAGQWQQDLPPPQLNSQTCWQLAGSASP
ALWRTWLIERSDGVTLWREFLLDEAPGSLLATLREQGLAETLELKWIYQAGGALWLALGV
ETEMPETVNILIDRYLEALRHTGEAQHQHYHQLTQQRFVTLSPMEQLRQRAVGFAPDEAL
PALLLLLERLNAAPGTLLCCTPQPPSENLITQGYSLALTHWQPAPPDALPAVNFTFYPLD
AAITPDPLPEESVALPHYQSDNLNPVLILRPEFYSTFTAEVGEALGRRLRPLFAALRHQG
GNGCWQEVEGVWQLTLQLTTDEAVTDQALSQIVCALSLPVEANLPSPVESIAIRALQQQL
PYQLAATFAPDCWRAALKGGNAALHSLIARRLSALSLPVNPDTPPKRMTTQTGMTRLLHA
STDNALLLFIPLHRPEQLAALRALALIYEPRFFQRYRVEQPIGYVVNSRYMRCADEDGVV
FALQSPDYSALSLLRYCRNFLRSLNETLAECDLVALKTRLLSREVAQPLAQLRRENGLAE
PDAAQIEALTLTDLQQLHRTLIQDRRRWRVLFTGGENV