Protein Info for IAI47_10000 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 85 to 128 (44 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 252 to 292 (41 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 312 (264 residues), 149.9 bits, see alignment E=4.1e-48

Best Hits

Swiss-Prot: 48% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to pam:PANA_1875)

MetaCyc: 43% identical to D-allose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-42-RXN [EC: 7.5.2.8]

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>IAI47_10000 ABC transporter permease (Pantoea sp. MT58)
MTTQTSTAPGTRPALRLKFNVRDAGTLIGLLIIVVTFSFLSPVFFTLPNLLNILQQSSIN
ALIALGMTLVIISGGIDLSVGPTAALSAVLGATLMTLGVPVPLAILATLGVGAMCGLFSG
SLIAYAGLQPFIVTLGGLSLFRAIALIYTGGNPVFGIPLAFRSLINSTVLGIPTPIVIVA
VIALLLWTVMNKTPLGEYILAIGGNEEAARVAGVPVKRTKVTVYIFSGLLASLASLILIG
RLGAAEPTIGNLWELDAIAAAAIGGASLMGGKGSIFGTLIGVVILGVLRNGLTLLNIQAF
YQLLATGLIIIIAMLIDRATRGK