Protein Info for IAI47_09985 in Pantoea sp. MT58

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16884: ADH_N_2
  • amino acids 10 to 115 (106 residues), 146.9 bits, E=2.9e-47
• PF00107: ADH_zinc_N
  • amino acids 161 to 299 (139 residues), 68 bits, E=1.2e-22
• PF13602: ADH_zinc_N_2
  • amino acids 194 to 339 (146 residues), 41.9 bits, E=2.9e-14

Best Hits

Swiss-Prot: 65% identical to CURA_ECOLI: NADPH-dependent curcumin reductase (curA) from Escherichia coli (strain K12)

KEGG orthology group: K07119, (no description) (inferred from 96% identity to pva:Pvag_1329)

MetaCyc: 65% identical to NADPH-dependent curcumin/dihydrocurcumin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6676; RXN0-6677

Predicted SEED Role

"Putative oxidoreductase YncB"

MetaCyc Pathways

• curcumin degradation (2/2 steps found)

Protein Sequence (343 amino acids)

>IAI47_09985 NADP-dependent oxidoreductase (Pantoea sp. MT58)
MTEHATQNHAWLLASRPHGEPTKENFRHVAQPVPEIKEGEVLLKTIYLSLDPYMRGRMDE
GKSYAAPAELDEPMVGGTVCQVAESKNSNFKTGDWVLAQSGWQEYAVSDGKEIAKLDNDM
PYPSWALGILGMPGFTAYMGLMDIGQPKAGETLVVAAATGPVGATVGQLGKQKGCRVVGV
AGGEEKCRYAVDTLGFDACLDHHSADFEEQLKNACPDGIDIYFENVGGKVFDAVFPLLNT
AARVPVCGLVSAYSQRELPDGPDRTSLIMAGILKRRIRMQGFIIFQDYGDRYPEFLKAMS
PLVESKKIHYREHMIEGLENAPQAFIDMLNGKNFGKTVVKVSE