Protein Info for IAI47_09945 in Pantoea sp. MT58

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 29 to 139 (111 residues), 140.6 bits, E=1.3e-45
• PF00576: Transthyretin
  • amino acids 31 to 139 (109 residues), 130.4 bits, E=2.1e-42

Best Hits

Swiss-Prot: 53% identical to HIUH_SALTY: 5-hydroxyisourate hydrolase (hiuH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 96% identity to pva:Pvag_1337)

MetaCyc: 53% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"Transthyretin family protein"

MetaCyc Pathways

• ureide biosynthesis (7/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• urate conversion to allantoin III (2/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (140 amino acids)

>IAI47_09945 hydroxyisourate hydrolase (Pantoea sp. MT58)
MKTSYALIATLLMASGASAIAAQPAAAKNPLSVHVLNLQTGQPTAGIEVELDQKQQDNWV
KLASGVTDNNGRISALFPQDKMASAGSYRVVFKTGDFYKKTNQKTFFPEIPVEFNMEASG
EHYHIPLLLSPFGYSTYRGN