Protein Info for IAI47_09885 in Pantoea sp. MT58

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 166 (141 residues), 126.2 bits, E=2.3e-40
• PF08402: TOBE_2
  • amino acids 280 to 348 (69 residues), 31.7 bits, E=2.1e-11

Best Hits

Swiss-Prot: 71% identical to FBPC_BRUA2: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Brucella abortus (strain 2308)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 98% identity to pva:Pvag_1356)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.30

Protein Sequence (353 amino acids)

>IAI47_09885 ABC transporter ATP-binding protein (Pantoea sp. MT58)
MTTINAGSVVFEHVAKRFAGFTAVPDLSLTVEPGTLVTLLGPSGCGKTTTLRLLAGLEHP
TSGRILIGGKEVTHLPANERDVAMVFQSYALFPHMNAIDNILYGLLSSGMNKREAQDRAR
EGLKLVGLESQGERLPSELSGGQQQRIAVARALVLEPQVLLLDEPLSNLDERLRRRVRTD
IRDLQQRLGFTAVYVTHDQEEALAVSDKIIVMKEGDIAQQGAPETLYHSPNSVFIADFMG
EANILPCEVEQADADDALVRLGNQRFRVRGAGAKTGSAQLAVRPQFITLSGDGQGALQGE
VIHSTWLGDHIEYEVATELGALFIIDPQMEQRLPLATLVGVNFKPQGLALIAR