Protein Info for IAI47_09865 in Pantoea sp. MT58

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 54 to 242 (189 residues), 167.6 bits, E=3.5e-53
• PF08659: KR
  • amino acids 56 to 218 (163 residues), 41.4 bits, E=2.2e-14
• PF13561: adh_short_C2
  • amino acids 61 to 293 (233 residues), 198 bits, E=2.8e-62

Best Hits

Swiss-Prot: 59% identical to YHXD_BACSU: Uncharacterized oxidoreductase YhxD (yhxD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_1361)

MetaCyc: 56% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase"

Protein Sequence (297 amino acids)

>IAI47_09865 SDR family oxidoreductase (Pantoea sp. MT58)
MATPTNKTLDLDQFPKPPFEDQPQQAPGLASKMIPVPDHGETSYRGTGRLTGRKALITGG
DSGIGRAVAIAYAREGADVVINYLPEEQPDADEVVKLIEAEGRKVFAIPGDIRSEEFCQQ
LVKDAADKLGGLDILVNNAGRQQFNESIRTLSTEDFDATFKTNVYAMFWITKAALEYLPR
GASIINTSSVQAFKPSDILLDYAQTKACIVAFTKSLAKQLGGEGIRVNAVAPGPYWTPLQ
SSGGQPMEKVKQFGADSPMGRPGQPVEIAPLYVTLASTESSYSSGQVWCSDGGTGTL