Protein Info for IAI47_09795 in Pantoea sp. MT58

Annotation: DUF1283 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06932: DUF1283" amino acids 26 to 107 (82 residues), 145.6 bits, see alignment E=2e-47

Best Hits

Swiss-Prot: 67% identical to Y1752_ERWT9: UPF0482 protein ETA_17520 (ETA_17520) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_1375)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>IAI47_09795 DUF1283 family protein (Pantoea sp. MT58)
MKKMIPAVLLVLISSAAFTASANTNRLIIEDGSTALGNEAARQDKEQWNDTRMLRNKVNT
RVEKEFDKADRAYDTRDKCEQSLNLNAYWEPNTLRCLDRRSGRPVAP