Protein Info for IAI47_09785 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 408 (389 residues), 187.3 bits, see alignment E=5.9e-59 PF06609: TRI12" amino acids 30 to 188 (159 residues), 29.8 bits, see alignment E=3.6e-11 PF00083: Sugar_tr" amino acids 48 to 196 (149 residues), 50.5 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to pva:Pvag_1377)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>IAI47_09785 MFS transporter (Pantoea sp. MT58)
MTESAQLQTGHRHWILIACMLAMFMAAIEVTIVATAMPTIIADLGGFSQFGWVFSIYLLT
QAVSVPLYGRLADMVGRKTMFFVGTAIFLVGSVLCGFAHTMTWLILFRAFQGLGAGAIMP
LSSTIVADIYSPRERASVQGWLSSVWGVAAIVGPLTGAWLVQHFSWSVIFWVNLPIGLMS
MLMLARWLPSHQKEEKSQPLNLAGSGWLMLCVTALLVALLQAEQLGIWLVPFLMFSLFAG
WQLKRHEQRSAAPLFPLIIWRSRLIVAGNAGNLIIGAAMMGISAFLPTWIQGIRGGSPLQ
AGSVLAMMSIGWPLASTLSGRLMLHTSYRFTAQLGALLLVTGSALLLFLQPASSLYQAGF
TAFLIGTGMGMTSTTFLVSVQNQADYQIRGICTASIMFSRMIGSAVGTAIMGAVLNLNLQ
WRLPQVQDPVQQIMSESSRQHLQPETLQQMVASIATSLHWVFVVALVIALFAVGVAWMMP
RQRPEQAD