Protein Info for IAI47_09780 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00528: BPD_transp_1
  • amino acids 62 to 234 (173 residues), 91.2 bits, E=3.6e-30

Best Hits

Swiss-Prot: 80% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 98% identity to pva:Pvag_1379)

Predicted SEED Role

"Putative ABC transporter membrane protein"

Protein Sequence (238 amino acids)

>IAI47_09780 ABC transporter permease (Pantoea sp. MT58)
MQNASLAQRAGLAVLAVVAVIAALIWGLGWDQLVARKVDLLYLGQQHLFLVFWSMLFALL
VGIPSGILLSRPFARRWAEYVMQIFNVGNTLPPLAVLALAMVIIGIGDRPALIALFLASL
LPIVRNTFSGLSAVPPSLIEAANGIGMTKWQRLRQVELPNALPVILAGVRIATAINVGTA
PLAFLIGASSFGELIFPGIYLNDFPTLILGAVATALVALVLDMLLAALGRFLSPHAAA