Protein Info for IAI47_09760 in Pantoea sp. MT58

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 295 to 311 (17 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 22 to 439 (418 residues), 361.8 bits, see alignment E=5.1e-112 PF00860: Xan_ur_permease" amino acids 23 to 409 (387 residues), 288 bits, see alignment E=4.9e-90 TIGR03173: xanthine permease" amino acids 26 to 441 (416 residues), 427.9 bits, see alignment E=3.5e-132

Best Hits

Swiss-Prot: 42% identical to XANP_SHIFL: Xanthine permease XanP (xanP) from Shigella flexneri

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 96% identity to pva:Pvag_1383)

MetaCyc: 42% identical to xanthine:H+ symporter XanP (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>IAI47_09760 purine permease (Pantoea sp. MT58)
MSHSHEKGLLYGLEARIGPAPAFLAALQHLLASVVGIITPPLIIGSVLGLNAYIPYLISM
SLFVSGLGTFMQARRFYGIGAGMICLQGTSFAFLGVILSGGLMVKGRGGSPEEIMAMLFG
CNLVAALIPILISRCVGSLRKVLTPVVTGTVITLIGISLIKVSITDWAGGHNATDFGSPG
NLALGALTLLVIVALNRSRNRWARLVAVVAGIAVGCVAAVLTGHLQLHVAPESSWMVLPA
FFRFGFAFDWTIFLPIALVSVIAVIEAVGDLTANCLISQQPIAGKPFQQRLQGGIVADGL
SCVLAAVFSAFPNTTFAQNNGVIQMTGVASRYVGMLLGIMLALLGLFPFVGSLLQQIPPP
VLGGATIVMFGSVVAAGIRVMTQTPLGRREMLIVAISFGIGLGVEAVPEVLKQFPPLINS
LFGHAVTTGGILAIMLNLVLPDEASAVEEVEAETLTES