Protein Info for IAI47_09740 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 261 (221 residues), 105.8 bits, see alignment E=1.2e-34 amino acids 270 to 411 (142 residues), 39.5 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 76% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 95% identity to pva:Pvag_1387)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>IAI47_09740 MFS transporter (Pantoea sp. MT58)
MSRSIQAAVDESAVSAPPESAAASGYIRRGTPAFMRVTLALFSAGLATFALLYCVQPILP
VMSQQFGVSPATSSLSLSISTGLMALGLLVTGPLSDAIGRKSVMVTALMLAAICTLISAT
MTSWHGILIMRGLMGLSLSGVAAVGMTYLSEEIDAQVVAFSMGLYISGNSIGGMSGRLLS
GVLTDLFSWRIAVALIGCFSLASALMFWKILPASRHFRPITLRPRNLLINFRLHWRDPGL
PWLFAEGFLLMGAFVTLFNYIGYRLLDAPWHLSQAVVGLLSVVYLTGSWSSPKAGALTSR
IGRGPVMLGATAIMLLGLLVTAFNSLWLILPGMMLFTAGFFAAHAVASGWIGPRARRARG
QASSLYLFSYYVGSSVAGTLGGLFWHNFGWGGITLFISVLLILALAVAWRLHSRKL