Protein Info for IAI47_09735 in Pantoea sp. MT58

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 350 (333 residues), 115.1 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 73% identical to SOTB_ERWT9: Probable sugar efflux transporter (sotB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K08159, MFS transporter, DHA1 family, L-arabinose/isopropyl-beta-D-thiogalactopyranoside export protein (inferred from 98% identity to pva:Pvag_1389)

MetaCyc: 66% identical to L-arabinose exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-40

Predicted SEED Role

"Sugar efflux transporter SotB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>IAI47_09735 sugar transporter (Pantoea sp. MT58)
MQSTTVSRKTAWLRVVLLAIAAFVFNTTEFVPVGLLSDIAADFSMPTADVGIMLTIYAWV
VALLSLPLMLLTRNIERRLLLGVLFLIFIVSHILSTVAWDFRSLMVSRVGIALSHAVFWS
ITASLAIRVAPAGKKTQALSMLATGTALAMVLGVPIGRVVGQYLGWRTTFGAIGLSALVL
MIMLVRILPRLPSEHTGSLSSVPMLFRRPALVSMYLLVTLVVTAHYTAYSYIEPFMQNVA
HSSGNFTTLLLLLFGSAGIVGSVLFSTLGNKFPSGLLIAAIALITLCMGLLIFAAVRPAA
ISTLCVVWGMAMMMIGLGMQVRVLSLAPDATDVAMSLMSGIYNIGIGAGALLGNQVSLHL
SMAEVGNVGGMIGLVALLWCIYIFRRYPQLRSNG