Protein Info for IAI47_09695 in Pantoea sp. MT58

Annotation: HTH-type transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF02311: AraC_binding" amino acids 18 to 148 (131 residues), 66.9 bits, see alignment E=2.3e-22 PF00165: HTH_AraC" amino acids 181 to 220 (40 residues), 28.8 bits, see alignment 1.6e-10 amino acids 231 to 266 (36 residues), 42.8 bits, see alignment 6.4e-15 PF12833: HTH_18" amino acids 192 to 270 (79 residues), 93.3 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 66% identical to RHAS_ECO27: HTH-type transcriptional activator RhaS (rhaS) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K02855, AraC family transcriptional regulator, L-rhamnose operon regulatory protein RhaS (inferred from 94% identity to pva:Pvag_1397)

Predicted SEED Role

"L-rhamnose operon regulatory protein RhaS" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>IAI47_09695 HTH-type transcriptional activator RhaS (Pantoea sp. MT58)
MTILHSADFFPEGDYAIAIEPRHPQAAFPEHHHDFHEIVLVEQGAGIHVFNGQPQTLCAG
CVCFVRDHDRHLYEQTDNLCLTNVLYRSPGAFRFLSGLQALLPRDQDGQYRSHWRINHKV
MTQALCVASQMQPDESWSLEKQARQEQLFLQLLVLLREACIDGQSQDLEARLHRLLDWLG
DHYSDEIVWDELADRFSLSLRTLHRQMKQQTGSTPQRYLNRLRLLQARHLLRHSDMRITD
IAFQCGFGDSNHFSTLFRREFGCAPRTERQQML