Protein Info for IAI47_09595 in Pantoea sp. MT58

Annotation: aromatic acid/H+ symport family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 281 (252 residues), 114.7 bits, see alignment E=7e-37 amino acids 262 to 435 (174 residues), 64.7 bits, see alignment E=1.1e-21 PF06779: MFS_4" amino acids 46 to 197 (152 residues), 42 bits, see alignment E=1.3e-14 PF00083: Sugar_tr" amino acids 57 to 244 (188 residues), 78.3 bits, see alignment E=9.1e-26

Best Hits

Swiss-Prot: 46% identical to PCAK_ACIAD: 4-hydroxybenzoate transporter PcaK (pcaK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 97% identity to pva:Pvag_1416)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>IAI47_09595 aromatic acid/H+ symport family MFS transporter (Pantoea sp. MT58)
MTSIEAVDVRQLINQQQLSPWQKRLIALCFIVVALDGMDIAIMGFIAPTLKAAWGVTNHQ
LGVVISAALIGLALGAMVAGPLADRYGRRMMIILSVFFFGLWTLATALSQNIEQMMLFRF
LTGLGLGAAMPNVGTLVAEYAPERRRAFLITVVFCGFTFGAASGGFAASWLLPRYNWHSV
LLLGGILPLLVLPLLIRGLPESVRFLISRGAPAARIHAILDRMMPGKTRPDCAFHAPEVS
VPAGGAIGTVLSRRYLFGSTMLWGGYFMGLFMVYLIGSWLPSLVNTLGMSVTEAAIITAM
YQAGGTLGSLFAGWMMDRFNANLALAAIYGCGGLFIVALGFSPAEVGMMSAIAFCSGFCF
NGANTGMNALSASYYPTHARATGSSWMHGVGRIGAILSAFVGAEMMSLGWSFSVIFLLLA
IPAVITTLMLLLKNRYGFKPITDS